- Recombinant Saccharomyces cerevisiae Putative maintenance of telomere capping protein 7 (MTC7)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1140896
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 16,094 Da
- E Coli or Yeast
- 1-139
- Putative maintenance of telomere capping protein 7 (MTC7)
Sequence
MKKEKKTPTPLPSHHVLFAEPGFFLCNFFFVLLKHTQINPFFYFLFILLFIIYIAIIYFVFIRISHFSFSLCRQCNSLGRMIFMCAYLPAASSRSVANPALPPQKKKKKKKKGTLRTGEVEEQAKGNISFDLCGKQNFQ